PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G25650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 386aa    MW: 43349.6 Da    PI: 4.6168
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G25650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573116.21.8e-3665160398
       DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  + r+w+eeDe+++L+Gl+d++aktg +p+ d+dafy+f+ +si +k+sk+q+++Kir+LK++f+ +++k+++g++p+f++++d+++f++s++iWg+
  AT2G25650.1  65 IVRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFYSFLGSSIVAKFSKEQVLSKIRKLKRRFHVHWEKISEGNDPKFTRSSDSEAFGFSSMIWGQ 160
                  68********************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.7E-2866159IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MVTPKQIDFS SCGGGDNSDD TLSHRESPRN PSSKRAAASF AAEAGEETMK KKKKKKKKNL  60
GPPLIVRIWN EEDELSILKG LVDYRAKTGF NPKIDWDAFY SFLGSSIVAK FSKEQVLSKI  120
RKLKRRFHVH WEKISEGNDP KFTRSSDSEA FGFSSMIWGQ GEFGNDDGMD KEMVKEHDVN  180
GNGAAENGTA RIAQENESGE EMLKEHEETL NENGAEEIRD NDETARKAQQ LESESEEEML  240
KEHEEPFNEN GAENIRDNNG TTQIAQQSES ESEEMLKEHE EVANTELVNE NGAAKTTENG  300
TTGGKERHDD DDDDELCAVQ DAFEAVMSQG LSGYQKKLQL EKLMNLGTGK RRELSDEWKA  360
LCVEERRLNI KKLRFSAKLA EAANDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14957KKKKKKKKK
25157KKKKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.256320.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306828420.0
Genevisible265907_at0.0
Expression AtlasAT2G25650-
AtGenExpressAT2G25650-
ATTED-IIAT2G25650-
Function -- GeneRIF ? help Back to Top
  1. GeBP/GPLs regulate a set of genes that represents a subset of the CPR5 pathway.
    [PMID: 21875893]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G25650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G36340, AT4G00270, AT5G06950, AT5G14280
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G25650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0721640.0AY072164.1 Arabidopsis thaliana unknown protein (At2g25650) mRNA, complete cds.
GenBankAY0842230.0AY084223.1 Arabidopsis thaliana clone 100283 mRNA, complete sequence.
GenBankAY0964170.0AY096417.1 Arabidopsis thaliana unknown protein (At2g25650) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565602.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ8VYD20.0Q8VYD2_ARATH; DNA-binding storekeeper protein-related transcriptional regulator
STRINGAT2G25650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Representative plantOGRP4222523
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Jen CH, et al.
    The Arabidopsis co-expression tool (ACT): a WWW-based tool and database for microarray-based gene expression analysis.
    Plant J., 2006. 46(2): p. 336-48
    [PMID:16623895]
  3. Chevalier F, et al.
    GeBP and GeBP-like proteins are noncanonical leucine-zipper transcription factors that regulate cytokinin response in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1142-54
    [PMID:18162594]
  4. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  5. Perazza D, et al.
    GeBP/GPL transcription factors regulate a subset of CPR5-dependent processes.
    Plant Physiol., 2011. 157(3): p. 1232-42
    [PMID:21875893]